PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA03G27230.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Dof
Protein Properties Length: 449aa    MW: 46805.2 Da    PI: 10.639
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA03G27230.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof111.63.5e-3548102559
           zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 
                        +cprC s++tkfCyynny++sqPr+fC+aCrryWt GG+lrnvP+Gg++rk+ 
  ONIVA03G27230.1  48 REQCPRCASHDTKFCYYNNYNTSQPRHFCRACRRYWTLGGSLRNVPIGGSTRKRP 102
                      579*************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088427.55949103IPR003851Zinc finger, Dof-type
PfamPF027011.2E-3049101IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-225096IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105187IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 449 aa     Download sequence    Send to blast
MPGQVMEAAL QQLPASMASG SLLLPPACIQ HPLPAAAAAS GGVGGSSREQ CPRCASHDTK  60
FCYYNNYNTS QPRHFCRACR RYWTLGGSLR NVPIGGSTRK RPRPPVRRPP VHFAAAAAPP  120
HHHHHHHGGP LTPPPATSSS SQQAGLLGSL FALGAAPLLE GRVGVGFDLG LGLPGPGHHH  180
AVAGGGGPAA AVATSSSSSA AAPLLWPTGL LDSSSNNAET WRMAAGGMWP EFTAAAAQNI  240
RLVIDIGDTT IQVPLNGPTV VQNIGRQAAA AVAGDSSAGG VSEKTGGAGG GGGEEWMQEQ  300
DGLLCMRGRR CGRRGGCLPR PRDWFAALLA ADPAAAAVTR DQAGKAMLYL IVNTCTFATS  360
LAVLPDAVRR RRRLRVEEGH READHQHDDG RRAVRRGDVR ALRRRRLPAH GPFVGTVVAA  420
VTVVVVRCNL ALPFRGGDAG HGCSWVSRL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
199103KRPRP
2390406RRAVRRGDVRALRRRRL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1072060.0AC107206.4 Oryza sativa chromosome 3 BAC OSJNBa0063J18 genomic sequence, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003559674.25e-56PREDICTED: dof zinc finger protein DOF1.7-like
TrEMBLA0A0E0GQJ80.0A0A0E0GQJ8_ORYNI; Uncharacterized protein
STRINGLOC_Os03g42200.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1257544
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.14e-25DOF zinc finger protein 1